Skip to product information
1 of 1

Gene Bio Systems

Recombinant Koribacter versatilis NADH-quinone oxidoreductase subunit K 2(nuoK2)

Recombinant Koribacter versatilis NADH-quinone oxidoreductase subunit K 2(nuoK2)

SKU:CSB-CF628022KAAA

Regular price £1,184.00 GBP
Regular price Sale price £1,184.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Koribacter versatilis (strain Ellin345)

Uniprot NO.:Q1IS42

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSSTIPLAWYLMLSAFLFICGVIGFMIKRNIITIFMCIELMLNAVNLTFVAYATELRSLS GHIFVFFVMVVAAAESAVGLGIIIAVFRSRETLNVDRVNLLKL

Protein Names:Recommended name: NADH-quinone oxidoreductase subunit K 2 EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I subunit K 2 NDH-1 subunit K 2

Gene Names:Name:nuoK2 Ordered Locus Names:Acid345_1306

Expression Region:1-103

Sequence Info:full length protein

View full details