Skip to product information
1 of 1

Gene Bio Systems

Recombinant Kluyveromyces lactis Golgi apparatus membrane protein TVP18(TVP18)

Recombinant Kluyveromyces lactis Golgi apparatus membrane protein TVP18(TVP18)

SKU:CSB-CF732036KBK

Regular price £1,247.00 GBP
Regular price Sale price £1,247.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)

Uniprot NO.:Q6CMQ1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVSVGFLKSMFNVSGMVADLKSSNFSIYGQWISYLNIIFCLAFGIANIFHFSAVIVFSII AIVQGLIILFIEVPFLLKICPLSDNFIGFVSKFDTNLRRALFYLVMCAIQWCSIIVQSTS LIVVAVGLSITATVYALGAAAGQEFKNSAILSDRGRVAASVTNEAVVRDML

Protein Names:Recommended name: Golgi apparatus membrane protein TVP18

Gene Names:Name:TVP18 Ordered Locus Names:KLLA0E18623g

Expression Region:1-171

Sequence Info:full length protein

View full details