Skip to product information
1 of 1

Gene Bio Systems

Recombinant Kluyveromyces lactis Glycosylphosphatidylinositol anchor biosynthesis protein 11(GPI11)

Recombinant Kluyveromyces lactis Glycosylphosphatidylinositol anchor biosynthesis protein 11(GPI11)

SKU:CSB-CF738387KBK

Regular price £1,301.00 GBP
Regular price Sale price £1,301.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)

Uniprot NO.:Q6CTT3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MHNRKRKTVKKTVSFSDDQNLTNANLNNHRKGHIDDDTPPVYVRKSWTLIPFHLLALLYW FLKYTDFNLLALLYIMIPTQVIYLIFRFNKNTIYGKKRLRLNWLLVFITLGACLLLSIPC LAIIVLFGAPFVELLKESWLLALHCCFLTYPAVYDVFNCNFKVGYFKKYFISVVIGCWIS CFVIPLDWDRDWQAWPVPLIVGAYLGSFIGFSIGGYI

Protein Names:Recommended name: Glycosylphosphatidylinositol anchor biosynthesis protein 11

Gene Names:Name:GPI11 Ordered Locus Names:KLLA0C10252g

Expression Region:1-217

Sequence Info:full length protein

View full details