Gene Bio Systems
Recombinant Klebsiella pneumoniae UPF0299 membrane protein KPK_1586 (KPK_1586)
Recombinant Klebsiella pneumoniae UPF0299 membrane protein KPK_1586 (KPK_1586)
SKU:CSB-CF477707KBH
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Klebsiella pneumoniae (strain 342)
Uniprot NO.:B5XP67
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSKSLTIIWQYLRAFVLIYACLYAGIFIAGLLPITIPGSIIGMLILFVLLALQIMPPQWV NPGCNILIRYMALLFVPIGVGVMQYWDLLRAQLGPVVISCAISTLVVFVVVSWSSHLVHG ERKVIGQKEKKNDA
Protein Names:Recommended name: UPF0299 membrane protein KPK_1586
Gene Names:Ordered Locus Names:KPK_1586
Expression Region:1-134
Sequence Info:full length protein
