Skip to product information
1 of 1

Gene Bio Systems

Recombinant Klebsiella pneumoniae subsp. pneumoniae Cysteine-O-acetylserine efflux protein(eamB)

Recombinant Klebsiella pneumoniae subsp. pneumoniae Cysteine-O-acetylserine efflux protein(eamB)

SKU:CSB-CF413279KAX

Regular price £1,269.00 GBP
Regular price Sale price £1,269.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

Uniprot NO.:A6T515

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTPTLISAFLTYTLITALTPGPNNILALSSVTSHGLRRSLRVLAGMSVGFIITMLICAAL TFSLVELDSRFTLVLGWIGAAYILWLAWQIAKSKPATGTPSVEPVGFWASLGLQFVNVKI ILYGITALSTFVLPVTREPVWLISVSLLLAAIGALGNLCWALAGHLFQRLFLLYGRQLNW MLAALLVYCAVRIVVE

Protein Names:Recommended name: Cysteine/O-acetylserine efflux protein

Gene Names:Name:eamB Ordered Locus Names:KPN78578_02250 ORF Names:KPN_00233

Expression Region:1-196

Sequence Info:full length protein

View full details