Gene Bio Systems
Recombinant Kalanchoe daigremontiana V-type proton ATPase 16 kDa proteolipid subunit
Recombinant Kalanchoe daigremontiana V-type proton ATPase 16 kDa proteolipid subunit
SKU:CSB-CF822145KAAJ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Kalanchoe daigremontiana (Devil's backbone) (Bryophyllum daigremontianum)
Uniprot NO.:Q96473
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV MAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGLACGLAGLSAGMAIGIVGDAG VRANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRAGQSRAD
Protein Names:Recommended name: V-type proton ATPase 16 kDa proteolipid subunit Short name= V-ATPase 16 kDa proteolipid subunit Alternative name(s): V-type H(+)-ATPase 16 kDa subunit Vacuolar proton pump 16 kDa proteolipid subunit
Gene Names:
Expression Region:1-165
Sequence Info:full length protein
