Skip to product information
1 of 1

Gene Bio Systems

Recombinant Isochrysis galbana Fucoxanthin-chlorophyll a-c binding protein, chloroplastic(FCP)

Recombinant Isochrysis galbana Fucoxanthin-chlorophyll a-c binding protein, chloroplastic(FCP)

SKU:CSB-CF661202IAAV

Regular price £1,272.00 GBP
Regular price Sale price £1,272.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Isochrysis galbana (Marine planktonic alga)

Uniprot NO.:Q39709

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:FAYGLPGGANILGEFDPAGFLKGKDKLEVYRLREAETTHGRVAMLASLGFVVQEKFHPLF SGDNGPAIEQIPQLPYWLWIVMTIGIGRAELFRIQKGWAKVNPETGKADSALREGYEPGD LGFDPLGLAPSDPDEFRLMQEKELSHGRLAMIAAAGFLAQEAVSGDTWGTYWGDATF

Protein Names:Recommended name: Fucoxanthin-chlorophyll a-c binding protein, chloroplastic Short name= FCP

Gene Names:Name:FCP

Expression Region:32-208

Sequence Info:full length protein

View full details