Skip to product information
1 of 1

Gene Bio Systems

Recombinant Invertebrate iridescent virus 6 Uncharacterized protein 169L (IIV6-169L)

Recombinant Invertebrate iridescent virus 6 Uncharacterized protein 169L (IIV6-169L)

SKU:CSB-CF530006INA

Regular price £1,208.00 GBP
Regular price Sale price £1,208.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Invertebrate iridescent virus 6 (IIV-6) (Chilo iridescent virus)

Uniprot NO.:O55762

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFSNISNQKLVLFFTIILIALCPFVYYLWDNEILGIGNWGRKRKDTFEDKNCSTEIEHAI EEHKRKNKEKKEAKEKRLAPGRVKISTYDVNNENYLLGDVNDELQPNIPGYLTKETAYPF DCEPDDRSNRWL

Protein Names:Recommended name: Uncharacterized protein 169L

Gene Names:ORF Names:IIV6-169L

Expression Region:1-132

Sequence Info:full length protein

View full details