Skip to product information
1 of 1

Gene Bio Systems

Recombinant Inner membrane protein yhaI(yhaI)

Recombinant Inner membrane protein yhaI(yhaI)

SKU:CSB-CF354336EOD

Regular price £1,220.00 GBP
Regular price Sale price £1,220.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Escherichia coli O157:H7

Uniprot NO.:P64593

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MQWYLSVLKNYVGFSGRARRKEYWMFTLINAIVGAIINVIQLILGLELPYLSMLYLLATF LPVLALAIRRLHDTDRSGAWALLFFVPFIGWLVLLVFFCTEGTSGSNRYGNDPKFGSN

Protein Names:Recommended name: Inner membrane protein yhaI

Gene Names:Name:yhaI Ordered Locus Names:Z4458, ECs3986

Expression Region:1-118

Sequence Info:full length protein

View full details