Recombinant Hypocrea jecorina Hydrophobin-2(hfb2)

SKU: CSB-EP304437HYE

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Microbiology

Uniprot ID: P79073

Gene Names: hfb2

Organism: Hypocrea jecorina (Trichoderma reesei)

AA Sequence: AVCPTGLFSNPLCCATNVLDLIGVDCKTPTIAVDTGAIFQAHCASKGSKPLCCVAPVADQALLCQKAIGTF

Expression Region: 16-86aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 23.2 kDa

Alternative Name(s): Hydrophobin II Short name: HFBII

Relevance: Responsible for spore hydrophobicity and protection.

Reference: "Atomic resolution structure of the HFBII hydrophobin, a self-assembling amphiphile."Hakanpaa J., Paananen A., Askolin S., Nakari-Setaelae T., Parkkinen T., Penttilae M., Linder M.B., Rouvinen J.J. Biol. Chem. 279:534-539(2004)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.