Skip to product information
1 of 1

Gene Bio Systems

Recombinant Hypocrea jecorina Hydrophobin-1(hfb1)

Recombinant Hypocrea jecorina Hydrophobin-1(hfb1)

SKU:CSB-EP347143HYE

Regular price £873.00 GBP
Regular price Sale price £873.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Microbiology

Uniprot ID: P52754

Gene Names: hfb1

Organism: Hypocrea jecorina (Trichoderma reesei)

AA Sequence: SNGNGNVCPPGLFSNPQCCATQVLGLIGLDCKVPSQNVYDGTDFRNVCAKTGAQPLCCVAPVAGQALLCQTAVGA

Expression Region: 23-97aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 23.5 kDa

Alternative Name(s): Hydrophobin I Short name:HFBI

Relevance: Contributes to surface hydrophobicity, which is important for processes such as association of hyphae in reproductive structures, dispersal of aerial spores and adhesion of pathogens to host structures.

Reference: "Genetic and biochemical characterization of the Trichoderma reesei hydrophobin HFBI."Nakari-Setaelae T., Aro N., Kalkkinen N., Alatalo E., Penttilae M.Eur. J. Biochem. 235:248-255(1996)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details