Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human UPF0468 protein C16orf80(C16orf80)

Recombinant Human UPF0468 protein C16orf80(C16orf80)

SKU:CSB-EP896752HU

Regular price £758.00 GBP
Regular price Sale price £758.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: Q9Y6A4

Gene Names: C16orf80

Organism: Homo sapiens (Human)

AA Sequence: MFKNTFQSGFLSILYSIGSKPLQIWDKKVRNGHIKRITDNDIQSLVLEIEGTNVSTTYITCPADPKKTLGIKLPFLVMIIKNLKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDDGWNQIQFNLLDFTRRAYGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFKLYLPVQNKAKQ

Expression Region: 1-193aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 49.8 kDa

Alternative Name(s): Basal body up-regulated protein 22 Transcription factor IIB

Relevance: Cilium- and flagellum-specific protein that plays a role in axonemal structure organization and motility. Involved in the regulation of the size and morphology of cilia. Required for axonemal microtubules polyglutamylation

Reference: "Bug22p, a conserved centrosomal/ciliary protein also present in higher plants, is required for an effective ciliary stroke in Paramecium." Laligne C., Klotz C., de Loubresse N.G., Lemullois M., Hori M., Laurent F.X., Papon J.F., Louis B., Cohen J., Koll F. Eukaryot. Cell 9:645-655(2010)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details