Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Uncharacterized protein ATPAF1-AS1(ATPAF1-AS1)

Recombinant Human Uncharacterized protein ATPAF1-AS1(ATPAF1-AS1)

SKU:CSB-CF750861HU

Regular price £1,271.00 GBP
Regular price Sale price £1,271.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q6PEX7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDSQQEDLRFPGMWVSLYFGILGLCSVITGGCIIFLHWRKNLRREEHAQQWVEVMRAATF TYSPLLYWINKRRRYGMNAAINTGPAPAVTKTETEVQNPDVLWDLDIPEGRSHADQDSNP KAEAPAPLQPALQLAPQQPQARSPFPLPIFQEVPFAPPLCNLPPLLNHSVSYPLATCPER NVLFHSLLNLAQEDHSFNAKPFPSEL

Protein Names:Recommended name: Uncharacterized protein ATPAF1-AS1 Alternative name(s): ATPAF1 antisense RNA 1 ATPAF1 antisense gene protein 1

Gene Names:Name:ATPAF1-AS1 Synonyms:C1orf223

Expression Region:1-206

Sequence Info:full length protein

View full details