Gene Bio Systems
Recombinant Human Tumor suppressor candidate 5(TUSC5)
Recombinant Human Tumor suppressor candidate 5(TUSC5)
SKU:CSB-CF025354HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:Q8IXB3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAHPVQSEFPSAQEPGSAAFLDLPEMEILLTKAENKDDKTLNLSKTLSGPLDLEQNSQGL PFKAISEGHLEAPLPRSPSRASSRRASSIATTSYAQDQEAPRDYLILAVVACFCPVWPLN LIPLIISIMSRSSMQQGNVDGARRLGRLARLLSITLIIMGIVIIMVAVTVNFTVQKK
Protein Names:Recommended name: Tumor suppressor candidate 5 Alternative name(s): Interferon-induced transmembrane domain-containing protein D3 Protein located at seventeen-p-thirteen point three 1
Gene Names:Name:TUSC5 Synonyms:IFITMD3, LOST1
Expression Region:1-177
Sequence Info:full length protein
