Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Tumor necrosis factor receptor superfamily member 25(TNFRSF25),partial

Recombinant Human Tumor necrosis factor receptor superfamily member 25(TNFRSF25),partial

SKU:CSB-EP839000HU

Regular price £582.00 GBP
Regular price Sale price £582.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Cell Biology

Uniprot ID: Q93038

Gene Names: TNFRSF25

Organism: Homo sapiens (Human)

AA Sequence: QGGTRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAPCTEPCGNSTCLVCPQDTFLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPGWFVECQVSQCVSSSPFYCQPCLDCGALHRHTRLLCSRRDTDCGTCLPGFYEHGDGCVSCPTSTLGSCPERCAAVCGWRQ

Expression Region: 25-199aa

Sequence Info: Extracellular Domain

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 22.9 kDa

Alternative Name(s): Apo-3 Apoptosis-inducing receptor AIR Apoptosis-mediating receptor DR3 Apoptosis-mediating receptor TRAMP Death receptor 3 Lymphocyte-associated receptor of death Short name:LARD

Relevance: Receptor for TNFSF12/APO3L/TWEAK. Interacts directly with the adapter TRADD. Mediates activation of NF-kappa-B and induces apoptosis. May play a role in regulating lymphocyte homeostasis.

Reference: "A death-domain-containing receptor that mediates apoptosis."Kitson J., Raven T., Jiang Y.-P., Goeddel D.V., Giles K.M., Pun K.-T., Grinham C.J., Brown R., Farrow S.N.Nature 384:372-375(1996)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details