Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Tumor-associated calcium signal transducer 2(TACSTD2)

Recombinant Human Tumor-associated calcium signal transducer 2(TACSTD2)

SKU:CSB-CF023072HU

Regular price £1,377.00 GBP
Regular price Sale price £1,377.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P09758

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL

Protein Names:Recommended name: Tumor-associated calcium signal transducer 2 Alternative name(s): Cell surface glycoprotein Trop-2 Membrane component chromosome 1 surface marker 1 Pancreatic carcinoma marker protein GA733-1

Gene Names:Name:TACSTD2 Synonyms:GA733-1, M1S1, TROP2

Expression Region:27-323

Sequence Info:full length protein

View full details