Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Transmembrane protein LINC00477(LINC00477)

Recombinant Human Transmembrane protein LINC00477(LINC00477)

SKU:CSB-CF839368HU

Regular price £1,237.00 GBP
Regular price Sale price £1,237.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q96M19

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLPFFSNTTSKSVSVSSFQGSPATPLSFLFFFFLCRAGSSMTGCFTFFLDFIFFFAGVLG PSPMGMYSGASTLTGFFLLRFLGQLSMDLEGLEWLGRASPSWWIFFSSSPSHRVPWGSCA SASAPRLPVPHPPSPLSKCPQHPRPRRTKGPGLRKLWGPGPPFFPS

Protein Names:Recommended name: Transmembrane protein LINC00477

Gene Names:Name:LINC00477 Synonyms:C12orf67

Expression Region:1-166

Sequence Info:full length protein

View full details