Gene Bio Systems
Recombinant Human Transmembrane protein 233(TMEM233)
Recombinant Human Transmembrane protein 233(TMEM233)
SKU:CSB-CF459503HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:B4DJY2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSQYAPSPDFKRALDSSPEANTEDDKTEEDVPMPKNYLWLTIVSCFCPAYPINIVALVFS IMSLNSYNDGDYEGARRLGRNAKWVAIASIIIGLLIIGISCAVHFTRNA
Protein Names:Recommended name: Transmembrane protein 233 Alternative name(s): Interferon-induced transmembrane domain-containing protein D2
Gene Names:Name:TMEM233 Synonyms:IFITMD2
Expression Region:1-109
Sequence Info:full length protein
