Gene Bio Systems
Recombinant Human TM2 domain-containing protein 2(TM2D2)
Recombinant Human TM2 domain-containing protein 2(TM2D2)
SKU:CSB-CF861157HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:Q9BX73
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:QNATAEPELTSAGAAQPEGPGGAASWEYGDPHSPVILCSYLPDEFIECEDPVDHVGNATA SQELGYGCLKFGGQAYSDVEHTSVQCHALDGIECASPRTFLRENKPCIKYTGHYFITTLL YSFFLGCFGVDRFCLGHTGTAVGKLLTLGGLGIWWFVDLILLITGGLMPSDGSNWCTVY
Protein Names:Recommended name: TM2 domain-containing protein 2 Alternative name(s): Beta-amyloid-binding protein-like protein 1 Short name= BBP-like protein 1
Gene Names:Name:TM2D2 Synonyms:BLP1
Expression Region:36-214
Sequence Info:full length protein
