Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Titin(TTN),partial

Recombinant Human Titin(TTN),partial

SKU:CSB-RP150794h

Regular price £580.00 GBP
Regular price Sale price £580.00 GBP
Sale Sold out
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Cardiovascular

Target / Protein: TTN

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Homo sapiens (Human)

Delivery time: 3-7 business days

Uniprot ID: Q8WZ42

AA Sequence: VFKCSVIGIPTPEVKWYKEYMCIEPDNIKYVISEEKGSHTLKIRNVCLSDSATYRCRAVNCVGEAICRGFLTMGDSEIFAVIAKKSKVTLSSLMEELVLKSNYTDSFFEFQVVEGPPRFIKGISDCYAPIGTAAYFQCLVRGSPRPTVYWYKDGKLVQGRRFTVEESGTGFHNLFITSLVKSDEGEYRCVATNKSGMAESFAALTLT

Tag info: N-terminal 6xHis-tagged

Expression Region: 5398-5604aa

Protein length: Partial of Isoform 6

MW: 26.5 kDa

Alternative Name(s): ConnectinRhabdomyosarcoma antigen MU-RMS-40.14

Relevance: Key component in the assbly and functioning of vertebrate striated muscles. By providing connections at the level of individual microfilaments, it contributes to the fine balance of forces between the two halves of the sarcomere. The >Several Other Sizes Are Also Available. Please Inquire. Default Size and extensibility of the cross-links are the main determinants of sarcomere extensibility properties of muscle. In non-muscle cells, ses to play a role in chromosome condensation and chromosome segregation during mitosis. Might link the lamina network to chromatin or nuclear actin, or both during interphase.

Reference: Titins, giant proteins in charge of muscle ultrastructure and elasticity.Labeit S., Kolmerer B.Science 270:293-296(1995)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details