Skip to product information
1 of 1

GeneBio Systems

Recombinant Human Thiamine transporter 2 (SLC19A3), partial

Recombinant Human Thiamine transporter 2 (SLC19A3), partial

SKU:Q9BZV2

Regular price £583.00 GBP
Regular price Sale price £583.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: Q9BZV2

Gene Names: SLC19A3

Alternative Name(s): (ThTr-2)(ThTr2)(Solute carrier family 19 member 3)

Abbreviation: Recombinant Human SLC19A3 protein, partial

Organism: Homo sapiens (Human)

Source: E.coli

Expression Region: 208-273aa

Protein Length: Partial

Tag Info: N-terminal 6xHis-tagged

Target Protein Sequence: KKSSSVNPVLEETHEGEAPGCEEQKPTSEILSTSGKLNKGQLNSLKPSNVTVDVFVQWFQDLKECY

MW: 11.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: DNA polymerase that promotes microhomology-mediated end-joining (MMEJ), an alternative non-homologous end-joining (NHEJ) machinery triggered in response to double-strand breaks in DNA.

Reference: "Cloning and chromosomal mapping of the human DNA polymerase theta (POLQ), the eighth human DNA polymerase." Sharief F.S., Vojta P.J., Ropp P.A., Copeland W.C. Genomics 59: 90-96(1999)

Function:

View full details