Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Tetraspanin-8(TSPAN8)

Recombinant Human Tetraspanin-8(TSPAN8)

SKU:CSB-CF025166HU

Regular price £1,298.00 GBP
Regular price Sale price £1,298.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P19075

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAGVSACIKYSMFTFNFLFWLCGILILALAIWVRVSNDSQAIFGSEDVGSSSYVAVDILI AVGAIIMILGFLGCCGAIKESRCMLLLFFIGLLLILLLQVATGILGAVFKSKSDRIVNET LYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRP CQSYNGKQVYKETCISFIKDFLAKNLIIVIGISFGLAVIEILGLVFSMVLYCQIGNK

Protein Names:Recommended name: Tetraspanin-8 Short name= Tspan-8 Alternative name(s): Transmembrane 4 superfamily member 3 Tumor-associated antigen CO-029

Gene Names:Name:TSPAN8 Synonyms:TM4SF3

Expression Region:1-237

Sequence Info:Full length protein

View full details