Skip to product information
1 of 1

GeneBio Systems

Recombinant Human Tetraspanin-8 (TSPAN8)-VLPs (Active)

Recombinant Human Tetraspanin-8 (TSPAN8)-VLPs (Active)

SKU:P19075

Regular price £1,246.00 GBP
Regular price Sale price £1,246.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Yes

Research Areas: Cancer

Uniprot ID: P19075

Gene Names: TSPAN8

Alternative Name(s): Transmembrane 4 superfamily member 3; Tumor-associated antigen CO-029

Abbreviation: Recombinant Human TSPAN8 protein-VLPs (Active)

Organism: Homo sapiens (Human)

Source: Mammalian cell

Expression Region: 1-237aa

Protein Length: Full Length

Tag Info: C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)

Target Protein Sequence: MAGVSACIKYSMFTFNFLFWLCGILILALAIWVRVSNDSQAIFGSEDVGSSSYVAVDILIAVGAIIMILGFLGCCGAIKESRCMLLLFFIGLLLILLLQVATGILGAVFKSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGKQVYKETCISFIKDFLAKNLIIVIGISFGLAVIEILGLVFSMVLYCQIGNK

MW: 27.4 kDa

Purity: The purity information is not available for VLPs proteins.

Endotoxin: Less than 1.0 EU/μg as determined by LAL method.

Biological_Activity: Measured by its binding ability in a functional ELISA. Immobilized Human TSPAN8 at 5 μg/mL can bind Anti-TSPAN8 recombinant antibody (CSB-RA025166MA1HU). The EC50 is 2.261-2.623 ng/mL.The VLPs (CSB-MP3838) is negative control.

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80℃. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: The VLPs are expressed from human 293 cells (HEK293).Mix the sample gently by repeatedly pipetting it up and down. Do not vortex.Repeated freezing and thawing is not recommended.Store the protein at -20℃/-80℃ upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity. The immunization strategy should be optimized (antigen dose, regimen and adjuvant).

Relevance: Structural component of specialized membrane microdomains known as tetraspanin-enriched microdomains (TERMs), which act as platforms for receptor clustering and signaling.

Reference: Silencing of long non-coding RNA SOX21-AS1 inhibits lung adenocarcinoma invasion and migration by impairing TSPAN8 via transcription factor GATA6. Xu Y., Wu H., Wu L., Xu L., Li J., Wang Q., Pu X. Int J Biol Macromol 164: 1294-1303 (2020)

Function:

View full details