Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human T-cell surface glycoprotein CD3 epsilon chain(CD3E),partial

Recombinant Human T-cell surface glycoprotein CD3 epsilon chain(CD3E),partial

SKU:CSB-YP004931HU

Regular price £652.00 GBP
Regular price Sale price £652.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Immunology

Uniprot ID: P07766

Gene Names: CD3E

Organism: Homo sapiens (Human)

AA Sequence: DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD

Expression Region: 23-126aa

Sequence Info: Extracellular Domain

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 13.8 kDa

Alternative Name(s): T-cell surface antigen T3/Leu-4 epsilon chain;CD_antigen: CD3e

Relevance: The CD3 complex mediates signal transduction, resulting in T-cell activation and proliferation. Required for normal immune responses (PubMed:15546002, PubMed:8490660).

Reference: "Isolation of cDNA clones encoding the 20K non-glycosylated polypeptide chain of the human T-cell receptor/T3 complex."Gold D.P., Puck J.M., Pettey C.L., Cho M., Coligan J., Woody J.N., Terhorst C.Nature 321:431-434(1986)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details