Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human T-cell receptor gamma chain C region 1(TRGC1)

Recombinant Human T-cell receptor gamma chain C region 1(TRGC1)

SKU:CSB-CF024416HU

Regular price £1,245.00 GBP
Regular price Sale price £1,245.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P0CF51

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:DKQLDADVSPKPTIFLPSIAETKLQKAGTYLCLLEKFFPDVIKIHWQEKKSNTILGSQEG NTMKTNDTYMKFSWLTVPEKSLDKEHRCIVRHENNKNGVDQEIIFPPIKTDVITMDPKDN CSKDANDTLLLQLTNTSAYYMYLLLLLKSVVYFAIITCCLLRRTAFCCNGEKS

Protein Names:Recommended name: T-cell receptor gamma chain C region 1

Gene Names:Name:TRGC1

Expression Region:1-173

Sequence Info:Full length protein

View full details