Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human T cell receptor beta constant 1(TRBC1),partial

Recombinant Human T cell receptor beta constant 1(TRBC1),partial

SKU:CSB-EP024291HU1

Regular price £426.00 GBP
Regular price Sale price £426.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Others

Uniprot ID:P01850

Gene Names:TRBC1

Organism:Homo sapiens (Human)

AA Sequence:DLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD

Expression Region:1-129aa

Sequence Info:Partial

Source:E.coli

Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged

MW:19.7 kDa

Alternative Name(s):TRBC1; T cell receptor beta constant 1

Relevance:Constant region of T cell receptor alpha chain. Alpha-beta T cell receptors are antigen specific receptors which are essential to the immune response and are present on the cell surface of T lymphocytes. Recognize peptide-major histocompatibility complexes that are displayed by antigen presenting cells, a prerequisite for efficient T cell adaptive immunity against pathogens. Binding of alpha-beta TR to pMH complex initiates TR-CD3 clustering on the cell surface and intracellular activation of LCK that phosphorylates the ITAM motifs of CD3G, CD3D, CD3E and CD247 enabling the recruitment of ZAP70. In turn ZAP70 phosphorylates LAT, which recruits numerous signaling molecules to form the LAT signalosome. The LAT signalosome propagates signal branching to three major signaling pathways, the calcium, the mitogen-activated protein kinase kinase and the nuclear factor NF-kappa-B pathways, leading to the mobilization of transcription factors that are critical for gene expression and essential for T cell growth and differentiation. The T cell repertoire is generated in the thymus, by V-(D)-J rearrangement. This repertoire is then shaped by intrathymic selection events to generate a peripheral T cell pool of self-MH restricted, non-autoaggressive T cells. Post-thymic interaction of alpha-beta TR with the pMH complexes shapes TR structural and functional avidity.

Reference:"Immunoglobulin and T Cell Receptor Genes: IMGT((R)) and the Birth and Rise of Immunoinformatics." Lefranc M.P. Front. Immunol. 5:22-22(2014)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

Lead Time Guidance:3-7 business days

View full details