Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human T-cell leukemia virus 1 Accessory protein p12I

Recombinant Human T-cell leukemia virus 1 Accessory protein p12I

SKU:CSB-CF366266HQJ

Regular price £1,178.00 GBP
Regular price Sale price £1,178.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Human T-cell leukemia virus 1 (strain Japan ATK-1 subtype A) (HTLV-1)

Uniprot NO.:P0C215

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLFRLLSPLSPLALTALLLFLLPPSDVSGLLLRPPPAPCLLLFLPFQILSGLLFLLFLPL FFSLPLLLSPSLPITMRFPARWRFLPWKAPSQPAAAFLF

Protein Names:Recommended name: Accessory protein p12I

Gene Names:

Expression Region:1-99

Sequence Info:full length protein

View full details