Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Synaptosomal-associated protein 29(SNAP29)

Recombinant Human Synaptosomal-associated protein 29(SNAP29)

SKU:CSB-EP021874HU

Regular price £581.00 GBP
Regular price Sale price £581.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Neuroscience

Uniprot ID: O95721

Gene Names: SNAP29

Organism: Homo sapiens (Human)

AA Sequence: MSAYPKSYNPFDDDGEDEGARPAPWRDARDLPDGPDAPADRQQYLRQEVLRRAEATAASTSRSLALMYESEKVGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFGGLVNYFKSKPVETPPEQNGTLTSQPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYPKNPHLRAYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTERKVRQL

Expression Region: 1-258aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 56 kDa

Alternative Name(s): Soluble 29KDA NSF attachment protein Vesicle-membrane fusion protein SNAP-29

Relevance: SNAREs, soluble N-ethylmaleimide-sensitive factor-attachment protein receptors, are essential proteins for fusion of cellular membranes. SNAREs localized on opposing membranes assemble to form a trans-SNARE complex, an extended, parallel four alpha-helical bundle that drives membrane fusion. SNAP29 is a SNARE involved in autophagy through the direct control of autophagosome membrane fusion with the lysososome membrane. Plays also a role in ciliogenesis by regulating membrane fusions.

Reference: "Three novel proteins of the syntaxin/SNAP-25 family." Steegmaier M., Yang B., Yoo J.-S., Huang B., Shen M., Yu S., Luo Y., Scheller R.H. J. Biol. Chem. 273:34171-34179(1998)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details