Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial(SDHD)

Recombinant Human Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial(SDHD)

SKU:CSB-CF020909HU

Regular price £1,187.00 GBP
Regular price Sale price £1,187.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:O14521

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SGSKAASLHWTSERVVSVLLLGLLPAAYLNPCSAMDYSLAAALTLHGHWGLGQVVTDYVH GDALQKAAKAGLLALSALTFAGLCYFNYHDVGICKAVAMLWKL

Protein Names:Recommended name: Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial Short name= CybS Alternative name(s): CII-4 QPs3 Succinate dehydrogenase complex subunit D Succinate-ubiquinone oxidoreductase cyto

Gene Names:Name:SDHD Synonyms:SDH4

Expression Region:57-159

Sequence Info:Full length protein

View full details