Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Small proline-rich protein 2B(SPRR2B)

Recombinant Human Small proline-rich protein 2B(SPRR2B)

SKU:CSB-YP022613HUb1

Regular price £863.00 GBP
Regular price Sale price £863.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Others

Uniprot ID: P35325

Gene Names: SPRR2B

Organism: Homo sapiens (Human)

AA Sequence: MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQPKYPPKSK

Expression Region: 1-72aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

MW: 12 kDa

Alternative Name(s):

Relevance: Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane.

Reference: "Structural organization and regulation of the small proline-rich family of cornified envelope precursors suggest a role in adaptive barrier function." Cabral A., Voskamp P., Cleton-Jansen A.-M., South A., Nizetic D., Backendorf C. J. Biol. Chem. 276:19231-19237(2001)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details