Recombinant Human Slit homolog 3 protein (SLIT3), partial

SKU: O75094

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Cell Biology

Uniprot ID: O75094

Gene Names: SLIT3

Alternative Name(s): (Slit-3)(Multiple epidermal growth factor-like domains protein 5)(Multiple EGF-like domains protein 5)

Abbreviation: Recombinant Human SLIT3 protein, partial

Organism: Homo sapiens (Human)

Source: E.coli

Expression Region: 34-155aa

Protein Length: Partial

Tag Info: N-terminal 6xHis-tagged

Target Protein Sequence: CPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLDLSENQIQGIPRKAFRG

MW: 17.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: May act as molecular guidance cue in cellular migration, and function may be mediated by interaction with roundabout homolog receptors.

Reference: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14: 2121-2127(2004)

Function: