Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Serine-rich and transmembrane domain-containing protein 1(SERTM1)

Recombinant Human Serine-rich and transmembrane domain-containing protein 1(SERTM1)

SKU:CSB-CF003124HU

Regular price £1,083.00 GBP
Regular price Sale price £1,083.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:A2A2V5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSEPDTSSGFSGSVENGTFLELFPTSLSTSVDPSSGHLSNVYIYVSIFLSLLAFLLLLLI IALQRLKNIISSSSSYPEYPSDAGSSFTNLEVCSISSQRSTFSNLSS

Protein Names:Recommended name: Serine-rich and transmembrane domain-containing protein 1

Gene Names:Name:SERTM1 Synonyms:C13orf36

Expression Region:1-107

Sequence Info:Full length protein

View full details