Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Secreted Ly-6-uPAR-related protein 1(SLURP1)

Recombinant Human Secreted Ly-6-uPAR-related protein 1(SLURP1)

SKU:CSB-EP021784HU

Regular price £759.00 GBP
Regular price Sale price £759.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Cardiovascular

Uniprot ID: P55000

Gene Names: SLURP1

Organism: Homo sapiens (Human)

AA Sequence: LKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSEL

Expression Region: 23-103aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 12.9 kDa

Alternative Name(s): ARS component B ARS(component B)-81/S Anti-neoplastic urinary protein Short name:ANUP

Relevance: Has an antitumor activity. Was found to be a marker of late differentiation of the skin. Implicated in maintaining the physiological and structural integrity of the keratinocyte layers of the skin.

Reference: "Biological effects of SLURP-1 on human keratinocytes."Arredondo J., Chernyavsky A.I., Webber R.J., Grando S.A.J. Invest. Dermatol. 125:1236-1241(2005)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details