Gene Bio Systems
Recombinant Human SARS coronavirus Protein 7a (7a)
Recombinant Human SARS coronavirus Protein 7a (7a)
SKU:CSB-CF348675HQE
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Human SARS coronavirus (SARS-CoV) (Severe acute respiratory syndrome coronavirus)
Uniprot NO.:P59635
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:ELYHYQECVRGTTVLLKEPCPSGTYEGNSPFHPLADNKFALTCTSTHFAFACADGTRHTY QLRARSVSPKLFIRQEEVQQELYSPLFLIVAALVFLILCFTIKRKTE
Protein Names:Recommended name: Protein 7a Alternative name(s): Accessory protein 7a Protein U122 Protein X4
Gene Names:ORF Names:7a
Expression Region:16-122
Sequence Info:full length protein
