Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Ribonuclease 4(RNASE4)

Recombinant Human Ribonuclease 4(RNASE4)

SKU:CSB-BP019796HU

Regular price £1,686.00 GBP
Regular price Sale price £1,686.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Cardiovascular

Uniprot ID:P34096

Gene Names:RNASE4

Organism:Homo sapiens (Human)

AA Sequence:QDGMYQRFLRQHVHPEETGGSDRYCNLMMQRRKMTLYHCKRFNTFIHEDIWNIRSICSTTNIQCKNGKMNCHEGVVKVTDCRDTGSSRAPNCRYRAIASTRRVVIACEGNPQVPVHFDG

Expression Region:29-147aa

Sequence Info:Full Length of Mature Protein

Source:Baculovirus

Tag Info:N-terminal MBP-tagged and C-terminal 6xHis-tagged

MW:57.8 kDa

Alternative Name(s):RNS4

Relevance:This RNase has marked specificity towards the 3' side of uridine nucleotides.

Reference:"Human ribonuclease 4 (RNase 4): coding sequence, chromosomal localization and identification of two distinct transcripts in human somatic tissues." Rosenberg H.F., Dyer K.D. Nucleic Acids Res. 23:4290-4295(1995)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:This RNase has marked specificity towards the 3' side of uridine nucleotides.

Involvement in disease:

Subcellular Location:Secreted

Protein Families:Pancreatic ribonuclease family

Tissue Specificity:

Paythway:

HGNC Database Link:https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=HGNC:10047

UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Hs&CID=283749

KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?hsa:6038

STRING Database Link:https://string-db.org/network/9606.ENSP00000381081

OMIM Database Link:https://www.omim.org/entry/601030601030601030

Lead Time Guidance:28-38 business days

View full details