Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Ragulator complex protein LAMTOR3(LAMTOR3)

Recombinant Human Ragulator complex protein LAMTOR3(LAMTOR3)

SKU:CSB-EP013477HU

Regular price £580.00 GBP
Regular price Sale price £580.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Signal Transduction

Uniprot ID: Q9UHA4

Gene Names: LAMTOR3

Organism: Homo sapiens (Human)

AA Sequence: MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELRQVVEVS

Expression Region: 1-124aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 40.6 kDa

Alternative Name(s): Late endosomal/lysosomal adaptor and MAPK and MTOR activator 3

Relevance: As part of the Ragulator complex it is involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Activated by amino acids through a mechanism involving the lysosomal V-ATPase, the Ragulator functions as a guanine nucleotide exchange factor activating the small GTPases Rag. Activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated. Adapter protein that enhances the efficiency of the MAP kinase cascade facilitating the activation of MAPK2.

Reference: "Novel genes expressed in human dendritic cells." Li Y., Huang C., Ren S., Tu Y., Gu W., Wang Y., Han Z., Chen Z. Submitted (NOV-1999)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details