Recombinant Human Radiation-inducible immediate-early gene IEX-1(IER3)

SKU: CSB-CF011002HU

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P46695

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MCHSRSCHPTMTILQAPTPAPSTIPGPRRGSGPEIFTFDPLPEPAAAPAGRPSASRGHRKRSRRVLYPRVVRRQLPVEEPNPAKRLLFLLLTIVFCQILMAEEGVPAPLPPEDAPNAASLAPTPVSAVLEPFNLTSEPSDYALDLSTFLQQHPAAF

Protein Names:Recommended name: Radiation-inducible immediate-early gene IEX-1 Alternative name(s): Differentiation-dependent gene 2 protein Short name= Protein DIF-2 Immediate early protein GLY96 Immediate early response 3 protein PACAP-responsive gene 1 protein Short name= Protein PRG1

Gene Names:Name:IER3 Synonyms:DIF2, IEX1, PRG1

Expression Region:1-156

Sequence Info:full length protein