Gene Bio Systems
Recombinant Human Putative gonadotropin-releasing hormone II receptor(GNRHR2)
Recombinant Human Putative gonadotropin-releasing hormone II receptor(GNRHR2)
SKU:CSB-CF853477HU-GB
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:Q96P88
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSAGNGTPWGSAAGEEVWAGSGVEVEGSELPTFSAAAKVRVGVTIVLFVSSAGGNLAVLW SVTRREPSQLRPSPVRRLFIHLAAADLLVTFVVMPLDATWNITVQWLAVDIACRTLMFLK LMATYSAAFLPVVIGLDRQAAVLNPLGSRSGVRKLLGAAWGLSFLLAFPQLFLFHTVH
Protein Names:Recommended name: Putative gonadotropin-releasing hormone II receptor Short name= GnRH II receptor Short name= GnRH-II-R Alternative name(s): Type II GnRH receptor
Gene Names:Name:GNRHR2
Expression Region:1-178
Sequence Info:full length protein
