Gene Bio Systems
Recombinant Human Protein NKG7(NKG7)
Recombinant Human Protein NKG7(NKG7)
SKU:CSB-CF613690HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:Q16617
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MELCRSLALLGGSLGLMFCLIALSTDFWFEAVGPTHSAHSGLWPTGHGDIISGYIHVTQT FSIMAVLWALVSVSFLVLSCFPSLFPPGHGPLVSTTAAFAAAISMVVAMAVYTSERWDQP PHPQIQTFFSWSFYLGWVSAILLLCTGALSLGAHCGGPRPGYETL
Protein Names:Recommended name: Protein NKG7 Alternative name(s): G-CSF-induced gene 1 protein Short name= GIG-1 protein Granule membrane protein of 17 kDa Short name= GMP-17 Natural killer cell protein 7 p15-TIA-1
Gene Names:Name:NKG7 Synonyms:GIG1
Expression Region:1-165
Sequence Info:full length protein
