Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Prolactin-inducible protein(PIP)

Recombinant Human Prolactin-inducible protein(PIP)

SKU:CSB-YP018020HU

Regular price £664.00 GBP
Regular price Sale price £664.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Signal Transduction

Uniprot ID: P12273

Gene Names: PIP

Organism: Homo sapiens (Human)

AA Sequence: QDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE

Expression Region: 29-146aa

Sequence Info: Full Length of Mature Protein

Source: Yeast

Tag Info: N-terminal 10xHis-tagged

MW: 16 kDa

Alternative Name(s): Gross cystic disease fluid protein 15

Relevance:

Reference: "The prolactin-inducible protein (PIP/GCDFP-15) gene: cloning, structure and regulation." Myal Y., Iwasiow B., Tsuyuki D., Wong P., Shiu R.P.C. Mol. Cell. Endocrinol. 80:165-175(1991)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details