Gene Bio Systems
Recombinant Human Programmed cell death 1 ligand 1(CD274),partial
Recombinant Human Programmed cell death 1 ligand 1(CD274),partial
SKU:CSB-EP878942HU2
Couldn't load pickup availability
Size:100ug. Other sizes are also available. For further information, please contact us.
Research Areas:Cancer
Uniprot ID:Q9NZQ7
Gene Names:CD274
Organism:Homo sapiens (Human)
AA Sequence:FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPY
Expression Region:19-134aa
Sequence Info:Partial
Source:E.coli
Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW:20.8 kDa
Alternative Name(s):PD-L1;PDCD1 ligand 1;Programmed death ligand 1;hPD-L1;B7 homolog 1;B7-H1;CD274
Relevance:Plays a critical role in induction and maintenance of immune tolerance to self (PubMed:11015443, PubMed:28813417, PubMed:28813410). As a ligand for the inhibitory receptor PDCD1/PD-1, modulates the activation threshold of T-cells and limits T-cell effector response (PubMed:11015443, PubMed:28813417, PubMed:28813410). Through a yet unknown activating receptor, may costimulate T-cell subsets that predominantly produce interleukin-10 (IL10) (PubMed:10581077).
Reference:"CMTM6 maintains the expression of PD-L1 and regulates anti-tumour immunity." Burr M.L., Sparbier C.E., Chan Y.C., Williamson J.C., Woods K., Beavis P.A., Lam E.Y.N., Henderson M.A., Bell C.C., Stolzenburg S., Gilan O., Bloor S., Noori T., Morgens D.W., Bassik M.C., Neeson P.J., Behren A., Darcy P.K. Dawson M.A. Nature 549:101-105(2017)
Purity:Greater than 90% as determined by SDS-PAGE.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link:
Lead Time Guidance:3-7 business days
