Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Probable G-protein coupled receptor 75(GPR75),partial

Recombinant Human Probable G-protein coupled receptor 75(GPR75),partial

SKU:CSB-YP009829HU

Regular price £649.00 GBP
Regular price Sale price £649.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Signal Transduction

Uniprot ID: O95800

Gene Names: GPR75

Organism: Homo sapiens (Human)

AA Sequence: NPFIYSRNSAGLRRKVLWCLQYIGLGFFCCKQKTRLRAMGKGNLEVNRNKSSHHETNSAYMLSPKPQKKFVDQACGPSHSKESMVSPKISAGHQHCGQSSSTPINTRIEPYYSIYNSSPSQEESSPCNLQPVNSFGFANSYIAMHYHTTNDLVQEYDSTSAKQIPVPSV

Expression Region: 372-540aa

Sequence Info: Cytoplasmic Domain

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 20.9 kDa

Alternative Name(s):

Relevance: G protein-coupled receptor that is activated by the chemokine CCL5/RANTES. Probably coupled to heterotrimeric Gq proteins, it stimulates inositol trisphosphate production and calcium mobilization upon activation. Together with CCL5/RANTES, may play a role in neuron survival through activation of a downstream signaling pathway involving the PI3, Akt and MAP kinases. CCL5/RANTES may also regulate insulin secretion by pancreatic islet cells through activation of this receptor

Reference: "The novel chemokine receptor, G-protein-coupled receptor 75, is expressed by islets and is coupled to stimulation of insulin secretion and improved glucose homeostasis."Liu B., Hassan Z., Amisten S., King A.J., Bowe J.E., Huang G.C., Jones P.M., Persaud S.J.Diabetologia 56:2467-2476(2013)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details