Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human PRA1 family protein 3(ARL6IP5)

Recombinant Human PRA1 family protein 3(ARL6IP5)

SKU:CSB-CF002096HU

Regular price £1,256.00 GBP
Regular price Sale price £1,256.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:O75915

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDVNIAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISIVGF LSPFNMILGGIVVVLVFTGFVWAAHNKDVLRRMKKRYPTTFVMVVMLASYFLISMFGGVM VFVFGITFPLLLMFIHASLRLRNLKNKLENKMEGIGLKRTPMGIVLDALEQQEEGINRLT DYISKVKE

Protein Names:Recommended name: PRA1 family protein 3 Alternative name(s): ADP-ribosylation factor-like protein 6-interacting protein 5 Short name= ARL-6-interacting protein 5 Short name= Aip-5 Cytoskeleton-related vitamin A-responsive protein

Gene Names:Name:ARL6IP5 Synonyms:DERP11, JWA, PRA2, PRAF3 ORF Names:HSPC127

Expression Region:1-188

Sequence Info:Full length protein

View full details