Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Plexin-B1(PLXNB1),partial (Active)

Recombinant Human Plexin-B1(PLXNB1),partial (Active)

SKU:CSB-MP018222HU2k6

Regular price £477.00 GBP
Regular price Sale price £477.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. Please contact us.

Research Areas:Neuroscience

Uniprot NO.:O43157

Uniprot Entry Name:

Gene Names:PLXNB1

Species:Homo sapiens (Human)

Source:Mammalian cell

Expression Region:20-535aa

Sequence:LQPLPPTAFTPNGTYLQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVSTGPVLDSRDCLPPVMPDECPQAQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDTQYVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSRGVGGGIPPITTRALWPPDPQAAFSYEETAKLAVGRLSEYSHHFVSAFARGASAYFLFLRRDLQAQSRAFRAYVSRVCLRDQHYYSYVELPLACEGGRYGLIQAAAVATSREVAHGEVLFAAFSSAAPPTVGRPPSAAAGASGASALCAFPLDEVDRLANRTRDACYTREGRAEDGTEVAYIEYDVNSDCAQLPVDTLDAYPCGSDHTPSPMASRVPLEATPILEWPGIQLTAVAVTMEDGHTIAFLGDSQGQLHRVYLGPGSDGHPYSTQSIQQGSAVSRDLTFDGTFEHLYVMTQSTLLKVPVASCAQHLDCASCLAHRDPYCGWCVLLGRCSRRSECSRGQGPEQWLWSFQPELGCLQ

Protein Description:Partial

Tag Info:N-terminal mFc-tagged

Mol. Weight:83.2 kDa

Biological_Activity:Measured by its binding ability in a functional ELISA. Immobilized human SEMA4D (CSB-MP835707HUd9) at 5 ?g/mL can bind human PLXNB1, the EC50 is 0.8179-1.357 ?g/mL.

Purity:Greater than 95% as determined by SDS-PAGE.

Endotoxin:Less than 1.0 EU/ug as determined by LAL method.

Form:Lyophilized powder

Buffer:Lyophilized from a 0.2 ?m filtered PBS, 6% Trehalose, pH 7.4

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Alternative Name/ Alias:(Semaphorin receptor SEP)

Relevance:Receptor for SEMA4D (PubMed:19843518, PubMed:20877282, PubMed:21912513). Plays a role in GABAergic synapse development. Mediates SEMA4A- and SEMA4D-dependent inhibitory synapse development. Plays a role in RHOA activation and subsequent changes of the actin cytoskeleton (PubMed:12196628, PubMed:15210733). Plays a role in axon guidance, invasive growth and cell migration (PubMed:12198496).

PubMed ID:

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

View full details