Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Pituitary tumor-transforming gene 1 protein-interacting protein(PTTG1IP)

Recombinant Human Pituitary tumor-transforming gene 1 protein-interacting protein(PTTG1IP)

SKU:CSB-CF019075HU

Regular price £1,244.00 GBP
Regular price Sale price £1,244.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P53801

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:QEPPGAACSQNTNKTCEECLKNVSCLWCNTNKACLDYPVTSVLPPASLCKLSSARWGVCWVNFEALIITMSVVGGTLLLGIAICCCCCCRRKRSRKPDRSEEKAMREREERRIRQEERRAEMKTRHDEIRKKYGLFKEENPYARFENN

Protein Names:Recommended name: Pituitary tumor-transforming gene 1 protein-interacting protein Alternative name(s): Pituitary tumor-transforming gene protein-binding factor Short name= PBF Short name= PTTG-binding factor

Gene Names:Name:PTTG1IP Synonyms:C21orf1, C21orf3

Expression Region:33-180

Sequence Info:full length protein

View full details