Gene Bio Systems
Recombinant Human Pituitary tumor-transforming gene 1 protein-interacting protein(PTTG1IP)
Recombinant Human Pituitary tumor-transforming gene 1 protein-interacting protein(PTTG1IP)
SKU:CSB-CF019075HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:P53801
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:QEPPGAACSQNTNKTCEECLKNVSCLWCNTNKACLDYPVTSVLPPASLCKLSSARWGVCWVNFEALIITMSVVGGTLLLGIAICCCCCCRRKRSRKPDRSEEKAMREREERRIRQEERRAEMKTRHDEIRKKYGLFKEENPYARFENN
Protein Names:Recommended name: Pituitary tumor-transforming gene 1 protein-interacting protein Alternative name(s): Pituitary tumor-transforming gene protein-binding factor Short name= PBF Short name= PTTG-binding factor
Gene Names:Name:PTTG1IP Synonyms:C21orf1, C21orf3
Expression Region:33-180
Sequence Info:full length protein
