Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Peroxisomal membrane protein 2(PXMP2)

Recombinant Human Peroxisomal membrane protein 2(PXMP2)

SKU:CSB-CF889089HU

Regular price £1,261.00 GBP
Regular price Sale price £1,261.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q9NR77

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:APAASRLRAEAGLGALPRRALAQYLLFLRLYPVLTKAATSGILSALGNFLAQMIEKKRKK ENSRSLDVGGPLRYAVYGFFFTGPLSHFFYFFMEHWIPPEVPLAGLRRLLLDRLVFAPAF LMLFFLIMNFLEGKDASAFAAKMRGGFWPALRMNWRVWTPLQFININYVPLKFRVLFANL AALFWYAYLASLGK

Protein Names:Recommended name: Peroxisomal membrane protein 2 Alternative name(s): 22 kDa peroxisomal membrane protein

Gene Names:Name:PXMP2 Synonyms:PMP22

Expression Region:2-195

Sequence Info:full length protein

View full details