Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human papillomavirus type 52 Protein E6(E6)

Recombinant Human papillomavirus type 52 Protein E6(E6)

SKU:CSB-EP334186HNY

Regular price £581.00 GBP
Regular price Sale price £581.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P36814

Gene Names: E6

Organism: Human papillomavirus type 52

AA Sequence: MFEDPATRPRTLHELCEVLEESVHEIRLQCVQCKKELQRREVYKFLFTDLRIVYRDNNPYGVCIMCLRFLSKISEYRHYQYSLYGKTLEERVKKPLSEITIRCIICQTPLCPEEKERHVNANKRFHNIMGRWTGRCSECWRPRPVTQV

Expression Region: 1-148aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 33.9 kDa

Alternative Name(s):

Relevance: Transcriptional transactivator. Binds double-stranded DNA .

Reference: Primer-directed sequencing of human papillomavirus types.Delius H., Hofmann B.Curr. Top. Microbiol. Immunol. 186:13-31(1994)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details