Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Oxytocin-neurophysin 1(OXT)

Recombinant Human Oxytocin-neurophysin 1(OXT)

SKU:CSB-YP017315HU(A4)a4

Regular price £769.00 GBP
Regular price Sale price £769.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: P01178

Gene Names: OXT

Organism: Homo sapiens (Human)

AA Sequence: CYIQNCPLGGKRAAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR

Expression Region: 20-125aa

Sequence Info: Full Length of Mature Protein

Source: Yeast

Tag Info: N-terminal 6xHis-sumostar-tagged

MW: 26.9 kDa

Alternative Name(s): Ocytocin

Relevance: Neurophysin 1 specifically binds oxytocin. Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland.

Reference: "The neurohypophyseal hormones vasopressin and oxytocin. Precursor structure, synthesis and regulation." Rehbein M., Hillers M., Mohr E., Ivell R., Morley S., Schmale H., Richter D. Biol. Chem. Hoppe-Seyler 367:695-704(1986)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details