Gene Bio Systems
Recombinant Human Oligosaccharyltransferase complex subunit OSTC(OSTC)
Recombinant Human Oligosaccharyltransferase complex subunit OSTC(OSTC)
SKU:CSB-CF882089HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:Q9NRP0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:METLYRVPFLVLECPNLKLKKPPWLHMPSAMTVYALVVVSYFLITGGIIYDVIVEPPSVG SMTDEHGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNAPNIPKLNRFLL LFIGFVCVLLSFFMARVFMRMKLPGYLMG
Protein Names:Recommended name: Oligosaccharyltransferase complex subunit OSTC Alternative name(s): Hydrophobic protein HSF-28
Gene Names:Name:OSTC ORF Names:DC2, HDCMD45P, HSPC307
Expression Region:1-149
Sequence Info:full length protein
