Recombinant Human Olfactory receptor 1A1(OR1A1)

SKU: CSB-CF865201HU

Size: 10ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Neuroscience

Uniprot ID: Q9P1Q5

Gene Names: OR1A1

Organism: Homo sapiens (Human)

AA Sequence: MRENNQSSTLEFILLGVTGQQEQEDFFYILFLFIYPITLIGNLLIVLAICSDVRLHNPMYFLLANLSLVDIFFSSVTIPKMLANHLLGSKSISFGGCLTQMYFMIALGNTDSYILAAMAYDRAVAISRPLHYTTIMSPRSCIWLIAGSWVIGNANALPHTLLTASLSFCGNQEVANFYCDITPLLKLSCSDIHFHVKMMYLGVGIFSVPLLCIIVSYIRVFSTVFQVPSTKGVLKAFSTCGSHLTVVSLYYGTVMGTYFRPLTNYSLKDAVITVMYTAVTPMLNPFIYSLRNRDMKAALRKLFNKRISS

Expression Region: 1-309aa

Sequence Info: Full Length

Source: in vitro E.coli expression system

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 50.6 kDa

Alternative Name(s): Olfactory receptor 17-7

Relevance: Odorant receptor.

Reference: "Structural determinants of odorant recognition by the human olfactory receptors OR1A1 and OR1A2." Schmiedeberg K., Shirokova E., Weber H.P., Schilling B., Meyerhof W., Krautwurst D. J. Struct. Biol. 159:400-412(2007)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.